PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A03G1469
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 290aa    MW: 31164.5 Da    PI: 7.8423
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A03G1469genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.83.2e-101154344
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                      W+ e d+ + +a + ++ +   +W++Ia+ ++ g+ lk++k+++
      Gh_A03G1469 11 EWSREQDKAFENALATYPEDsldRWEKIAADVP-GKNLKEIKEHY 54
                     7********************************.**********9 PP

2Myb_DNA-binding43.95.7e-14122166347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ + +++G+g+W++I+r +  +Rt+ q+ s+ qky
      Gh_A03G1469 122 AWTEDEHRLFLLGLEKYGKGDWRSISRNFVVTRTPTQVASHAQKY 166
                      6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.3E-6355IPR009057Homeodomain-like
PROSITE profilePS512938.11762IPR017884SANT domain
SMARTSM007177.7E-9860IPR001005SANT/Myb domain
SuperFamilySSF466891.51E-101063IPR009057Homeodomain-like
PfamPF002491.7E-71154IPR001005SANT/Myb domain
CDDcd001679.39E-91157No hitNo description
PROSITE profilePS5129417.61114171IPR017930Myb domain
SuperFamilySSF466897.9E-17117172IPR009057Homeodomain-like
SMARTSM007174.5E-11119169IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.4E-17119169IPR006447Myb domain, plants
PfamPF002497.1E-12122166IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-11122165IPR009057Homeodomain-like
CDDcd001671.21E-10122167No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MTLEEAVNSS EWSREQDKAF ENALATYPED SLDRWEKIAA DVPGKNLKEI KEHYELLEDD  60
VNRIVSGCVP LPPYNSFEGS TGHAGDEGTG KKGSGHLSHC NNDSNHGSKN SRSDQERRKG  120
IAWTEDEHRL FLLGLEKYGK GDWRSISRNF VVTRTPTQVA SHAQKYFIRL NSMNKDRRRS  180
SIHDITSVGN GDIASQGPIT GQSNGAAAGG SSAKSAKQTS QHPASPPGIG MYGAPTIGQP  240
IGGPLVSAVG RPVNLPASAH MGYGVTVPGA PMNMGPATYP MPHSTAHSHR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A6e-1512761175RADIALIS
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.260620.0boll
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012479854.10.0PREDICTED: transcription factor DIVARICATA
RefseqXP_012479856.10.0PREDICTED: transcription factor DIVARICATA
RefseqXP_012479857.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-63DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0B0PST80.0A0A0B0PST8_G
STRINGGLYMA07G28310.11e-156(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35562861
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-117MYB family protein